Bacterial taxon 243277
Locus VC_A0800
Protein NP_233186.1
creA protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 160 aa, Gene n/a, UniProt Q9KLE6
>NP_233186.1|Vibrio cholerae O1 biovar El Tor str. N16961|creA protein
MLNSIRTALLLSFAFVLSGCDRSEVGDVSLGMFTLKDIKINNLTDPVVTGVTCHVASIEADLSLADPSDSSISCRQTGEITPEMIAQIDKSSSGEVVFQKSKSIFFKSMKIRRIFDAKNQTLMYLSYSTKETSGSFKHSLSTVPLWGTQAYNAFPETQNK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.29 | 0.044 | ●○○○○ -0.46 | -0.46211317233681903 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)