Bacterial taxon 243277
Locus VC_2053
Protein NP_231685.1
cytochrome c-type biogenesis protein CcmE
Vibrio cholerae O1 biovar El Tor str. N16961
Length 160 aa, Gene ccmE, UniProt Q9KQE7
>NP_231685.1|Vibrio cholerae O1 biovar El Tor str. N16961|cytochrome c-type biogenesis protein CcmE
MNPRRKKRLGVVLAILFGLSATIGLIIYALNQNMDLFYTPTELVYGKEGKKPEIGQRLRIGGMVVEGSVKRDPNSLKVSFDLHDVGPSITVTYDGILPDLFREGQGIVAQGVLVEPTKIEAFEVLAKHDENYMPPEIAEAMKKTHAPLQYSQEQKQGSDQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.75 | 0.0035 | ○○○○○ 0.06 | 0.05703510001113698 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)