Bacterial taxon 243277
Locus VC_0089
Protein NP_229748.1
cytochrome c551 peroxidase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 333 aa, Gene n/a, UniProt Q9KVQ2
>NP_229748.1|Vibrio cholerae O1 biovar El Tor str. N16961|cytochrome c551 peroxidase
MKVVLTSLSLAISLSLAGYAFAASPRNEPVSPILPAQEIHIGKAELGKKLYFDPRLSKSGFISCNSCHNLSMGGSDNLKTSIGHNWQQGPINSPTVLNSSLNIAQFWDGRAADLKEQAGGPIANPGEMAFTHTLAIDVLQSIPAYVSEFRLVFGKPTLDIDQVTEAIAEFEKTLVTPYSRFDQWLMGDDSAITAQELAGYELFKNSGCVACHNGSALGGNSFQKMGLIEPYQTNNKVEGLSAVTGADADRFKFKVPTLRNVALTYPYFHDGEAATLKDAVDIMGRLQLGRKFTDDENGKIVAFLHTLTGEQPSFALPILPPSNDNTPKPQPFD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.96 | 1.3e-5 | ●○○○○ -0.5 | -0.4983438747732216 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)