Bacterial taxon 243277
Locus VC_A0766
Protein NP_233152.2
cytochrome c554
Vibrio cholerae O1 biovar El Tor str. N16961
Length 102 aa, Gene n/a, UniProt Q9KLH8
>NP_233152.2|Vibrio cholerae O1 biovar El Tor str. N16961|cytochrome c554
MRVVCSLLCLTLVSTPLFASGDPVLGKQKAPSCVFCHGTDGKATQVSYPNLDGQSAEYLYSAMKAYQLGERTGPMAEMMRAQLQRLNDQDLRDIAAFYASSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.11 | 0.00043 | ○○○○○ 1.08 | 1.0777685824293384 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)