Bacterial taxon 243277
Locus VC_A0127
Protein NP_232528.2
D-ribose pyranase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 139 aa, Gene rbsD, UniProt Q9KN38
>NP_232528.2|Vibrio cholerae O1 biovar El Tor str. N16961|D-ribose pyranase
MKKSTLLNSELSYLVATLGHTDEITICDAGLPIPDEVTRIDLALTHGVPSFLETVRVILSESQIESVIVAQEFAQVSPVLHEALYRELKAEEQLCGKPIAIQYISHEAFKQRTLQSRAVVRTGECTPYANVIFQAGVVF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.83 | 0.0023 | ○○○○○ 0.9 | 0.8987815474758315 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)