Bacterial taxon 243277
Locus VC_A0573
Protein NP_232963.1
DamX-like protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 195 aa, Gene n/a, UniProt Q9KM16
>NP_232963.1|Vibrio cholerae O1 biovar El Tor str. N16961|DamX-like protein
MTISMKKIAVIGLSALLAACASGEYTTDVKTESHREEYSVAAVEQPVISEYGVADGISEQNVEQNVVKMTPDSEKKVVKMSPQAKPAVSITPPSAKQVAMNPRYGFTIQVVAVGAQSKVDQFASKLPRNGQPIWENYKLVNGTKWYTVLYGDYATRQEAAAAISSLPVELREMKPFVKSIDSIKNSEFPTLNKLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.62 | 0.003 | ●○○○○ -0.03 | -0.032139549177848684 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)