Bacterial taxon 243277
Locus VC_2240
Protein NP_231871.1
decarboxylase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 174 aa, Gene padC, UniProt Q9KPX2
>NP_231871.1|Vibrio cholerae O1 biovar El Tor str. N16961|decarboxylase
MRFERNDLSGFLGKSFIYNYDQGWRYELYVKNATTIDYRVHSGIVGGRWVKDQTVHISRVGAAIYRVSWAEPTGTSVALTLNLEDYVVHGAIYFPRWIVDEPEKIACYQNDHLPLMEAYRDAGPIYPTHVIDSFATLIYMRDCGLNNEQVINCPPSELAEDYPFCLADKNLLPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.41 | 0.0099 | ○○○○○ 0.22 | 0.21591380577556632 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)