Bacterial taxon 243277
Locus VC_A0840
Protein NP_233226.1
deoxycytidylate deaminase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 161 aa, Gene n/a, UniProt Q9KLA6
>NP_233226.1|Vibrio cholerae O1 biovar El Tor str. N16961|deoxycytidylate deaminase
MISKWAQRFFQMAELVGSWSKDPSTQVGAVITKQNRIVSVGFNGYPHGISDSASTDDRDMKYLKTLHAEENAILFAKRDLDGCEIYVTHFPCPNCAAKIIQTGISAVHCPEQSEDFLSRWGDKIKVSQDMFLQAGVKVHWLPLVELKHINTIELPSESSNP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.13 | 2.5e-7 | ●●○○○ -1.65 | -1.6490581548389014 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)