Bacterial taxon 243277
Locus VC_1491
Protein NP_231132.1
dihydroorotate dehydrogenase 2
Vibrio cholerae O1 biovar El Tor str. N16961
Length 336 aa, Gene pyrD, UniProt Q9KRZ2
>NP_231132.1|Vibrio cholerae O1 biovar El Tor str. N16961|dihydroorotate dehydrogenase 2
MLYRLARAGFFQLDAEKAHDLAISNFKRFTGTPFDLFYRQQLPHRPVQCMGLTFKNPVGLAAGLDKNGECIEAFGAMGFGFVEVGTVTPRPQAGNDKPRLFRLVHAEGIINRMGFNNLGVDHLVENVKRAKYDGIIGINIGKNKDTPIEKGAEDYLICMDKVYPYAGYIAVNISSPNTPGLRSLQYGEALDELLAALKTRQAELAAKHDKYVPLALKIAPDLSDDEIQQICQSLLKNKIDSVIATNTTLDRSLVEGMKFANEAGGLSGRPLQNRSTEVIKCLYKELGEEIPIIGVGGIDSYISAKEKLLAGAKLVQVYSGFIYQGPGLVADIVKNL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.85 | 6.9e-6 | ●●○○○ -1.83 | -1.8302696218940813 | 24331463 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)