Bacterial taxon 243277
Locus VC_0671
Protein NP_230320.1
dinucleoside polyphosphate hydrolase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 193 aa, Gene rppH, UniProt Q9KU53
>NP_230320.1|Vibrio cholerae O1 biovar El Tor str. N16961|dinucleoside polyphosphate hydrolase
MLRLGICGKINAIKEFTRGLPVIDGDGYRLNVGIVICNNHGQVFWAKRYGQHSWQFPQGGIDDGESPEQAMFRELYEEVGLTKKDVKVIATSRHWLRYKLPKRLVRWDSQPVCIGQKQKWFLLRLECDESKINMQRGSSPEFDGWRWVSYWYPVRQVVSFKRDVYRRAMKEFASLAMPFKERKVKGKRNTHRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.63 | 0.033 | ○○○○○ 0.11 | 0.1141225029087733 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)