Bacterial taxon 243277
Locus VC_1902
Protein NP_231536.1
disulfide bond formation protein B
Vibrio cholerae O1 biovar El Tor str. N16961
Length 173 aa, Gene dsbB, UniProt Q9KQU6
>NP_231536.1|Vibrio cholerae O1 biovar El Tor str. N16961|disulfide bond formation protein B
MRILSSLKTFSQSRLSWLLLLAFVVFFTLCAMYFQHVMLLAPCVMCIYERIAMLGIGVAALIGAIAPQNPVVRWLGFAAWGASSYKGLMLAIEHVNYQFNPSPFATCDLFVTFPAWAPLNQWAPNLFEAYGDCSKVVWQFLTLSMPQWLVVIFAANLLALAIFVVAQLAKTSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.26 | 3.2e-9 | ●●○○○ -1.1 | -1.0990619645915245 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)