Bacterial taxon 243277
Locus VC_1542
Protein NP_231182.1
DNA ligase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 282 aa, Gene n/a, UniProt Q9KRU2
>NP_231182.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA ligase
MLIRLTLTAAAIMLAQQTLANDGPLAFIPITYANNYQHGIDIFDYWKSEKLDGIRAIWTGKQLVTRNGNPIAAPAWFTESLPSYSLEGELWAGRGNFSLVQQTVLDSQPADSAWRKISLMLFDMPDAAGDYSKRYYNLIHLVNSLDLKHIRYVEHTPIKSEAELLSYLDNISEKSGEGVMLRKISARYQAGRSNDLLKLKRHQDAEATVIGYRLGMGKYKGKMGSMLVRTAEGLEFYIGSGFSDVERAEPPKIGSVITYRYNGLTTEGKPRFARFVRVRENY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.26 | 0.0001 | ●○○○○ -0.18 | -0.17697606997028265 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)