Bacterial taxon 243277
Locus VC_0668
Protein NP_230317.1
DNA mismatch repair protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 221 aa, Gene mutH, UniProt Q9KU56
>NP_230317.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA mismatch repair protein
MKPAPTTQQELLTRAQQIAGLSFAELADEAGMTVPPDLRKDKGWVGQLLEWHLGATAGSRPQQDFEHLGIELKSIPISYTGKPLETTFVCVAPLTGVHGLTWEQSHVRNKLSKVLWIPVQGEREIPLAERCVGSPLLWSPSPEEEAQLKADWEELMEWIVLGKVAQITAKHGEVLQLRPKAANGRALTEAYGANGRPIKALPRGFYLRTQFTAQILQRYYA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.26 | 1.6e-6 | ●●○○○ -1.1 | -1.0964660662125447 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)