Bacterial taxon 243277
Locus VC_2459
Protein NP_232088.1
DNA repair protein RecO
Vibrio cholerae O1 biovar El Tor str. N16961
Length 241 aa, Gene recO, UniProt Q9KPB4
>NP_232088.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA repair protein RecO
MSDGLQRCFVLHRRPYSESSLILDVFSEEYGRVTLMAKGARGKRSNLKGALQPFTPLLLKWSGNGSMKTLRQAEPISLGLPLSGVYLYSAMYINELVDRVLMPEVASPGLFHDYLFALTELAQSTNPEPALRRFELALLAAMGYGVDFLHCAGTGEPVSPDMTYRYREQKGFIASVRRDNLTFLGNELIAISERRFTSKEQLQAAKRFTRLALKPYLGGKPLKSRELFRQTTLPRARSTEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.49 | 0.0028 | ○○○○○ 0.18 | 0.1781759929055339 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)