Bacterial taxon 243277
Locus VC_1696
Protein NP_231332.2
DNA-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 77 aa, Gene n/a, UniProt Q9KRE6
>NP_231332.2|Vibrio cholerae O1 biovar El Tor str. N16961|DNA-binding protein
MKFTQQHIDELNLLLQFDLSSAATGIKVHHDASEAVQAAVVRLYNKGLCTQPDGGYLTDEGIEIAEHADRVLRVLNA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.57 | 9.1e-5 | ○○○○○ 0.14 | 0.14329508427273424 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)