Bacterial taxon 243277
Locus VC_0273
Protein NP_229929.1
DNA-binding protein HU
Vibrio cholerae O1 biovar El Tor str. N16961
Length 90 aa, Gene hupA, UniProt Q9KV83
>NP_229929.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA-binding protein HU
MNKTQLIDFIAEKADLTKVQAKAALEATLGAVEGALKDGDQVQLIGFGTFKVNHRSARTGRNPKTGEEIKIAAANVPAFVAGKALKDAIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.69 | 0.00028 | ○○○○○ 0.09 | 0.08502620007278584 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)