Bacterial taxon 243277
Locus VC_1638
Protein NP_231275.1
DNA-binding response regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 219 aa, Gene n/a, UniProt Q9KRK2
>NP_231275.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA-binding response regulator
MKILVVEDDVQLGQQILSALEQTGWVPELAQDGIDALYRATAEEWDVIVLDLGLPKLDGLTVLKGIRDENINTPVVILSARDTLTQRVEGLNAGADDYLTKPFEMVELIARIRAQLRRASGNASPVMQVGDLSLDTRTSKVMWQGQAVSLTALEYKVIAYFMHNPEKVISRTELVEHIYKQDFDRDSNTIEVFIGRIRKKIAPDVIKTVRGLGYQLHAN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.06 | 0.00055 | ○○○○○ 0.9 | 0.8956573710241468 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)