Bacterial taxon 243277
Locus VC_A1105
Protein NP_233484.1
DNA-binding response regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 218 aa, Gene n/a, UniProt Q9KKK0
>NP_233484.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA-binding response regulator
MRLLLVEDDTLLGESMQVALSRQGYTVDWLERGGGVVTALKTEQFTALILDLTLPDMDGLEVLRQIRRAGYTLPVMILTARDDISDRVKGLDGGADEYIGKPFALEELLARLRLIIRRSSGSAEELISVGELDLSLSKQEIYYAQQALKLTRNEYKILASLMTQAGRVMSKELLQQALHGWDEGSSDNAIEVHIHNLRKKLPDNLVKNVRGVGYMIEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.73 | 0.0012 | ○○○○○ 0.83 | 0.8296967873173787 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)