Bacterial taxon 243277
Locus VC_2709
Protein NP_232336.1
DNA-directed RNA polymerase subunit omega
Vibrio cholerae O1 biovar El Tor str. N16961
Length 90 aa, Gene rpoZ, UniProt Q9KNM3
>NP_232336.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA-directed RNA polymerase subunit omega
MARVTVQDAVEKIGNRFDLVLVAARRARQMQSGGKDALVPEENDKPTVIALREIEEGLITKDVLDARERQEQQEQEAAELAAVSSIMHNR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2,32 | 0,00022 | ○○○○○ 1,47 | 1.473150935201485 | 24331463 |
Retrieved 1 of 1 entries in 0,9 ms
(Link to these results)