Bacterial taxon 243277
Locus VC_0139
Protein NP_229797.1
DPS family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 156 aa, Gene n/a, UniProt Q9KVK4
>NP_229797.1|Vibrio cholerae O1 biovar El Tor str. N16961|DPS family protein
MATNLIGLDTTQSQKLANALNNLLANYQVFYMNTRGYHWNIQGKEFFELHAKFEEIYTDLQLKIDELAERILTLSARPMHSFSGYLKAAQIKEHTDSIDGRSSMQGLVDGFSILLHQQRDILELAGETGDEGTSALMSDYIREQEKLVWMLNAWLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.15 | 0.002 | ●○○○○ -0.59 | -0.5887029520797704 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)