Bacterial taxon 243277
Locus VC_1208
Protein NP_230853.1
dsDNA-mimic protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 106 aa, Gene n/a, UniProt Q9KSP8
>NP_230853.1|Vibrio cholerae O1 biovar El Tor str. N16961|dsDNA-mimic protein
MAELISIDDTIDTAYDIFLEMAPDNLEPADVILFTAQFDDRGAAELVDVGDDWDDQVGFEVDKEIYAEVRIGLVNEENDVLDDVFARMLISRDPDQKFCHMLWKRD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.45 | 0.026 | ○○○○○ 0.2 | 0.19792518052109367 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)