Bacterial taxon 243277
Locus VC_2660
Protein NP_232288.1
elongation factor P
Vibrio cholerae O1 biovar El Tor str. N16961
Length 188 aa, Gene efp, UniProt Q9KNS1
>NP_232288.1|Vibrio cholerae O1 biovar El Tor str. N16961|elongation factor P
MATVSTNEFKGGLKIMLDNEPCVILENEYVKPGKGQAFNRVRIRKLLTGKVLEKTFKSGDTAEVADVVDIDLDYLYNDGEFYHFMNNSTFEQLAADAKAVGENAKWLVENNTCMLTLWNGNPIAVTPPNFVELEVTETDPGVKGDTQGTGGKPATLSTGAVVRVPLFVQIGEVIKVDTRSAEYVGRVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1 | 5.1e-5 | ●○○○○ -0.06 | -0.057144810038236564 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)