Bacterial taxon 243277
Locus VC_0920
Protein NP_230567.1
exopolysaccharide biosynthesis protein EpsF
Vibrio cholerae O1 biovar El Tor str. N16961
Length 382 aa, Gene n/a, UniProt Q9KTI2
>NP_230567.1|Vibrio cholerae O1 biovar El Tor str. N16961|exopolysaccharide biosynthesis protein EpsF
MSKILLIMPLSTLNWGEKNLGGVDSVCQMLVRQLAQQERPYHYRVLAFDPLNNHSYSGEIIQLSKHLEVVICPLREKRFGLPLPSLLSNWLRIQEQLKDYQPDLVHSHLNSWMMGLGQKTRNVLTLHSYRKIGRKPVSKLNDFVYEQIIPWVSHFSVDFYTCVGEELRQALSLETNKSIQVIGNPVDPDYFSANSANQNLPQNEVNLVTCALITRRKRIDRAIVLLRELKQRGQAATLRIIGPNMDSAYYAQLQQLIKEYELEQDVIFLGKLNQREIVQQYQQANIGIFTSQQETFGLAPLEMMAAGLPLISTPVGILGERQATFDQLGVVFMQEGQEAMIAERISQIKITDTQAIQTYLRDQFAVENVIEHYQNLYREVLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.27 | 0.0017 | ○○○○○ 0.53 | 0.530786882024428 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)