Bacterial taxon 243277
Locus VC_2771
Protein NP_232397.1
F0F1 ATP synthase subunit I
Vibrio cholerae O1 biovar El Tor str. N16961
Length 129 aa, Gene atpI, UniProt Q9KNG8
>NP_232397.1|Vibrio cholerae O1 biovar El Tor str. N16961|F0F1 ATP synthase subunit I
MVAVLARQGRELAKRLLLIQFSAVMVAAAVFAVAVNGDWGLSALVGGGIFVIANAVFAGCAFLFAGARALKMVAISFYTGEALKILITIVLFSVAYMYMQLELVPLKLTYLLALGINICAPVLFINNKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.34 | 7.4e-5 | ●○○○○ -0.21 | -0.21340158043972857 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)