Bacterial taxon 243277
Locus VC_2106
Protein NP_231738.1
ferric uptake regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 150 aa, Gene fur, UniProt P0C6C8
>NP_231738.1|Vibrio cholerae O1 biovar El Tor str. N16961|ferric uptake regulator
MSDNNQALKDAGLKVTLPRLKILEVLQQPECQHISAEELYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDDVIEQRQKEIAAKYNVQLTNHSLYLYGKCGSDGSCKDNPNAHKPKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.39 | 0.0039 | ●○○○○ -0.24 | -0.23518423887263004 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)