Bacterial taxon 243277
Locus VC_0684
Protein NP_230333.1
FKBP-type peptidylprolyl isomerase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 144 aa, Gene n/a, UniProt Q9KU45
>NP_230333.1|Vibrio cholerae O1 biovar El Tor str. N16961|FKBP-type peptidylprolyl isomerase
MNPIASNSAVTLHFTIKLKDGSVADSTHNQGKPAKLVMGDGSLSPNFEQCLLGMLPGEKKSVALAAQDAFGAPNPDHVHYMDRSKFLGGDLQLEVGTIMAFSGPDGMEIPGIITEIAGDSVTVDFNHPLAGQDITFDVEILSVE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2.79 | 0.0016 | ○○○○○ 1.69 | 1.6929430009925195 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)