Bacterial taxon 243277
Locus VC_2198
Protein NP_231829.1
flagellar basal body rod modification protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 235 aa, Gene n/a, UniProt Q9KQ09
>NP_231829.1|Vibrio cholerae O1 biovar El Tor str. N16961|flagellar basal body rod modification protein
MAGVNNVGQSGLSYIDQLKALQEQKKPDETTGQKSLKQEDFLSLLTKQLAQQDPFKPVSNDQMIAQMASFATVDGIGKMNTQFESLNSSMTSNQALQASSLVGRDVLVPGAAGMKKPDGGMAAMVKLPQSIDNLFIRIENEAGQLVRTFDVGAKSSGDNRVEWDGKDQNGNPLPGGKYKVKASGLLDGESKEFEVSTYANVNSVLLGKGDGNVLLNLAGFDAPVRLAEVLEVGKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.58 | 0.00019 | ○○○○○ 0.14 | 0.1367009967730522 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)