Bacterial taxon 243277
Locus VC_2121
Protein NP_231752.1
flagellar biosynthesis protein FliR
Vibrio cholerae O1 biovar El Tor str. N16961
Length 260 aa, Gene n/a, UniProt Q9KQ80
>NP_231752.1|Vibrio cholerae O1 biovar El Tor str. N16961|flagellar biosynthesis protein FliR
MEYPASVVLDFIANYFWPYTRIAAMLMVMTVTGARFVPARVRLYLGLALTFAVMPAIPAVPSDIALLSLQGFMITFEQIVIGVAMGMVTQFLVQIFVMLGQILGMQSSLGFASMVDPANGQNTPLLGQLFMLLATLFFLVSDGHLKMIQLVVFSFKSLPIGSGSLTTVDFRELALWLGIMFKASLAVSLSGIIALLTVNLSFGVMTRAAPQLNIFSLGFSFALLVGLLLCWYIVHGLYTHYDIYWQEAEEQVCRLIRLNC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.38 | 3.7e-7 | ●○○○○ -0.69 | -0.6925778021486352 | 24331463 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)