Bacterial taxon 243277
Locus VC_2138
Protein NP_231769.1
flagellar protein FliS
Vibrio cholerae O1 biovar El Tor str. N16961
Length 136 aa, Gene fliS, UniProt Q9KQ65
>NP_231769.1|Vibrio cholerae O1 biovar El Tor str. N16961|flagellar protein FliS
MRGSLQAYKKVSVDSQLSAASPHKIVQMLMAGAIERLIQGKAAMQQGNIPVKGERLGKALDIIISLRSCLSMEDGGDIAKNLDQLYDFMVNQITQANHKNDPQMLDDVIEIIREIKSAWDQIPPEYHNLTAAEVGI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.11 | 0.019 | ○○○○○ 0.91 | 0.9146809262240881 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)