Bacterial taxon 243277
Locus VC_0002
Protein NP_062586.1
flavodoxin
Vibrio cholerae O1 biovar El Tor str. N16961
Length 144 aa, Gene mioC, UniProt Q9KVY6
>NP_062586.1|Vibrio cholerae O1 biovar El Tor str. N16961|flavodoxin
MIHIITGSTLGGAEYVGDHLSDLLQEQGFDTKIHNQPNMSEIPAKGTWLIITSTHGAGEYPDNIQPFIQALQNTPPNTSALRYAVVAIGDSSYDTFCAAGKHAYQLLGDIGAKPLANCFTIDVQEHPVPEDAAEAWLKRVINRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.71 | 0.031 | ○○○○○ 0.08 | 0.07756347737992511 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)