Bacterial taxon 243277
Locus VC_1695
Protein NP_231331.1
formate transporter 1
Vibrio cholerae O1 biovar El Tor str. N16961
Length 280 aa, Gene n/a, UniProt Q9KRE7
>NP_231331.1|Vibrio cholerae O1 biovar El Tor str. N16961|formate transporter 1
MEHNQFDSLLPPQMAERAAITGEGKAKKAAYKSFLLAISAGIQIGIAFVFYTVVTTGAHDMPYGVTKLLGGLAFSLGLILVVITGGELFTSSVLILVAKASGKISWKELVRNWTVVYFGNLCGSIILVFIMLATRQFMEDGGQLGLNAMAISQHKLHHTFLQAFALGLMCNILVCLAVWMTFSARSLTDKVMVLILPVAMFVSSGFEHCIANMFQVPMAIGIKYFAPESFWAMTGANIAQYADLNFVNFIVNNLIPVTLGNIVGGGVFVGMWYWLIYLKD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.86 | 8.4e-5 | ○○○○○ 0.8 | 0.8022638347493954 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)