Bacterial taxon 243277
Locus VC_0263
Protein NP_229919.1
galactosyl-transferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 184 aa, Gene n/a, UniProt Q9KV93
>NP_229919.1|Vibrio cholerae O1 biovar El Tor str. N16961|galactosyl-transferase
MVIRFLDFIFALAGLLLLWPVLLIVCILGYFDTGSPIFCQQRVGKNQRPFTLIKFRTMPKNTASVATHLVGASSVTRLGQFLRKTKLDELPQLINVLKGEMSLVGPRPCLFNQQDLIAERESRGVFTVLPGITGLAQVNEVDMSTPVKLAELDQQMIQTLNLKNYFTYIIQTVLGKGAGDRVKP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.12 | 4.7e-17 | ●●●○○ -2.88 | -2.8795355277289163 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)