Bacterial taxon 243277
Locus VC_2730
Protein NP_232357.1
general secretion pathway protein G
Vibrio cholerae O1 biovar El Tor str. N16961
Length 146 aa, Gene epsG, UniProt P45773
>NP_232357.1|Vibrio cholerae O1 biovar El Tor str. N16961|general secretion pathway protein G
MKKMRKQTGFTLLEVMVVVVILGILASFVVPNLLGNKEKADQQKAVTDIVALENALDMYKLDNSVYPTTDQGLEALVTKPTNPEPRNYREGGYIKRLPKDPWGNDYQYLSPGDKGTIDVFTLGADGQEGGEGTGADIGNWNIQDFQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.88 | 9.9e-7 | ●●○○○ -1.84 | -1.843740550001057 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)