Bacterial taxon 243277
Locus VC_2727
Protein NP_232354.1
general secretion pathway protein J
Vibrio cholerae O1 biovar El Tor str. N16961
Length 221 aa, Gene epsJ, UniProt P45776
>NP_232354.1|Vibrio cholerae O1 biovar El Tor str. N16961|general secretion pathway protein J
MWRTNQVSSRQNMAGFTLIEVLVAIAIFASLSVGAYQVLNQVQRSNEISAERTARLAELQRAMVIMDADFRQMALRQFRTDGEAPSEQILQWKESLLDSDQHGLLFVRLGWHNPQQQFPRGEVAKVGYRLFENRLERVWWRYPDTPAGQQGLISPLLTGVEDWAVQFYLQGEWSKEWVPTNALPEAVKVTLRLKDYGEIERIYLTGGGSLNMTQESVENAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.73 | 0.0056 | ●○○○○ -0.39 | -0.39174690129559364 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)