Bacterial taxon 243277
Locus VC_1146
Protein NP_230791.2
glutaredoxin 1
Vibrio cholerae O1 biovar El Tor str. N16961
Length 87 aa, Gene grx, UniProt Q9KSW0
>NP_230791.2|Vibrio cholerae O1 biovar El Tor str. N16961|glutaredoxin 1
MFVVIFGRPGCPYCVRAKEHAETLKAKRDDFNYRYVDIHAEGITKADLEKTIGKPVETVPQIFIDEQHIGGCTDFEAYAKENLGLFD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.5 | 0.016 | ○○○○○ 0.17 | 0.17420325357603256 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)