Bacterial taxon 243277
Locus VC_1347
Protein NP_230991.1
glutathione S-transferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 215 aa, Gene maiA, UniProt Q9KSB2
>NP_230991.1|Vibrio cholerae O1 biovar El Tor str. N16961|glutathione S-transferase
MMSLILYGYWRSSAAYRVRIALNIKQLVYESRAVHLSREGGEQHHAEFHRLNPSELIPVLIDGELCLNQSLAIIEYLDETYPAPRLIPERGAERYQVKALALDIAADIHPINNLRILQYLTAKLGVADEEKNRWYRHWIDKGFQGLEEKLRHTAGEYCVGNRLSLVDVCLVPQVYNAERFDLDMSRYPTLQQIAARLRALPAFAQAAPENQPDAC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.03 | 1.4e-5 | ●○○○○ -0.53 | -0.5323354229386994 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)