Bacterial taxon 243277
Locus VC_A0585
Protein NP_232975.1
glutathione S-transferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 203 aa, Gene n/a, UniProt Q9KM04
>NP_232975.1|Vibrio cholerae O1 biovar El Tor str. N16961|glutathione S-transferase
MKLYETAMTPSCRRVSIFLKELGIDVERVQVDVRGGENLSDTFKSKSLNGKVPLLELDEGTTLCESVAICRYFDLTYPNTHKLFGDSALEQAQVEMWHRVVEFQGLYAGFQAFRNLSGIYKDREHCVYAWGEESKARVAAFLPQLEQRLAQSRFIATDRFTIVDITAYIFIGFAQKALELSVFEHYPHITRWFEQLSQRPAFQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.47 | 0.028 | ○○○○○ 0.06 | 0.05960170106604308 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)