Bacterial taxon 243277
Locus VC_2159
Protein NP_231790.1
glycine cleavage system transcriptional repressor
Vibrio cholerae O1 biovar El Tor str. N16961
Length 180 aa, Gene n/a, UniProt Q9KQ45
>NP_231790.1|Vibrio cholerae O1 biovar El Tor str. N16961|glycine cleavage system transcriptional repressor
MTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSPSNITRVETTLPLLGQQHDLITMMKRTSPHDHQTHAYTVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSAQTISKDKLHSEQNQFHIAISARVDSGCNLMQLQEEFDALCTALDVQGSLNFIKNSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.56 | 0.043 | ○○○○○ 0.15 | 0.14722305070764366 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)