Bacterial taxon 243277
Locus VC_A0890
Protein NP_233275.1
glyoxylase I family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 127 aa, Gene n/a, UniProt Q9KL58
>NP_233275.1|Vibrio cholerae O1 biovar El Tor str. N16961|glyoxylase I family protein
MLKRIHHAAIICSDYPRSKAFYTEILGLRVLAENYRAARDSYKLDLALPDGSQIELFSFPKAPERPSFPEAQGLRHLAFVVDDVAEIKAQLEQQGVSVEPIRIDEYTGKAYTFFADPDGLPLELYQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.69 | 0.00055 | ●○○○○ -0.72 | -0.7226394820290282 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)