Bacterial taxon 243277
Locus VC_1270
Protein NP_230915.1
glyoxylase II family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 218 aa, Gene n/a, UniProt Q9KSI6
>NP_230915.1|Vibrio cholerae O1 biovar El Tor str. N16961|glyoxylase II family protein
MSLQYQVVPVTAFAQNCSIVWCDETMEGIVVDPGGDVKQLAMLIAELGVKVTQLVLTHGHLDHVGGTQSLAQALGGTRVVGPHKADNFWLQGLEGQSKMFGFPLTEAFEPDEWLDDGDVIHFGQQTLQVIHTPGHTPGHVVLFSEAARLAFVGDVLFNGSIGRTDFPQGDFNTLIASIKNKLWPLGSDVTFIPGHGPQSTFGRERASNPFVADEMPLY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.85 | 2.8e-10 | ●●●○○ -2.29 | -2.292631662216468 | 24331463 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)