Bacterial taxon 243277
Locus VC_2185
Protein NP_231816.2
GTP-dependent nucleic acid-binding protein EngD
Vibrio cholerae O1 biovar El Tor str. N16961
Length 363 aa, Gene ychF, UniProt Q9KQ20
>NP_231816.2|Vibrio cholerae O1 biovar El Tor str. N16961|GTP-dependent nucleic acid-binding protein EngD
MGFKCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPVPDPRLDALAAIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENENIIHVAGKVSPLEDIEIINLELALADLDSCERAILRQSKRAKGGDKEAKFELAVLEKLQPVLSEGQSARSVNLTKEELLAVGYLNLLTLKPTMYIANVNENGFENNPYLDAVVEFAAKENASVVAVCAAIEAELSELEEEERDEFLADLGIEEPGLNRVIRSGYDLLNLQTYFTAGVKEVRAWTIPVGATAPQAAGKIHTDFERGFIRAEVIGYNDYIQFNGESGAKDAGKWRLEGKEYIVKDGDVIHFRFNV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.79 | 3.5e-6 | ●○○○○ -0.42 | -0.42265135501330936 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)