Bacterial taxon 243277
Locus VC_A0017
Protein NP_232418.1
hcp protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 172 aa, Gene n/a, UniProt H9L4Q3
>NP_232418.1|Vibrio cholerae O1 biovar El Tor str. N16961|hcp protein
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.69 | 0.0092 | ○○○○○ 0.81 | 0.8093720844145182 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)