Bacterial taxon 243277
Locus VC_A0447
Protein NP_232841.1
hemagglutinin associated protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 230 aa, Gene n/a, UniProt H9L4S1
>NP_232841.1|Vibrio cholerae O1 biovar El Tor str. N16961|hemagglutinin associated protein
MLGYAFPSILGNLMSKIYQMDAVDWLKTLENCSVDLFITDPPYESLEKYRQIGTTTRLKESKSSSNQWFSVFPNTRFEELFREVYRVLKKGSHFYLFCDQETMFLAKPIAESVGFKFWKPIVWDKCAIGMGYHYRARYEFILFFEKGKRKLNDLSVPDVLEYKRVWKGYPTEKPVELLEVLIRQSSSENEIVADSFFGSGSTLIAANNLSRKYIGCDISSSAHEYFKNRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.45 | 0.049 | ○○○○○ 0.65 | 0.6495560388968088 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)