Bacterial taxon 243277
Locus VC_2056
Protein NP_231688.1
heme exporter protein B
Vibrio cholerae O1 biovar El Tor str. N16961
Length 222 aa, Gene n/a, UniProt Q9KQE4
>NP_231688.1|Vibrio cholerae O1 biovar El Tor str. N16961|heme exporter protein B
MMPAFIQFIHRELLIAFRRQADVFNPLWFFIIVITLFPLSVGPEPALLARIAPGIVWVAALLAALLSLERLFRDDFQDGALEQAMLTPLPLSVVVLAKVTAHWLLTGLPLILISPLLAILLSFDSSAWLAVVLTLLLGTPTLSFIGAIGVALTVGLQKGGVLLSLLVLPLFIPVLIFATSAIDAAALGMPYNGQLAILAAMLMGSMTLTPFAISAALRVSVH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2.96 | 0.0042 | ○○○○○ 1.77 | 1.7713586137987527 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)