Bacterial taxon 243277
Locus VC_0040
Protein NP_229699.1
hemolysin
Vibrio cholerae O1 biovar El Tor str. N16961
Length 215 aa, Gene n/a, UniProt Q9KVU9
>NP_229699.1|Vibrio cholerae O1 biovar El Tor str. N16961|hemolysin
MSMSNSYGFKEEVANAISHGVGLILGIVGLVLLLVKAVDQQADALTITSMSIYGGSMIALFLASTLYHAIPYQRAKRWLKTFDHCAIYLLIAGSYTPFLLVSLRTPLAVGLMIVIWSLALIGILMKIAFVYRFKKLSLVTYLTMGWLSLIVIYQLAIHLEVGGLTLLAAGGLIYSLGVIFYVAKRIPYNHAIWHAFVLAGCACHFLAIYLYVEPI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.47 | 0.016 | ○○○○○ 1.08 | 1.0846052502147692 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)