Bacterial taxon 243277
Locus VC_0959
Protein NP_230606.1
hemolysin
Vibrio cholerae O1 biovar El Tor str. N16961
Length 291 aa, Gene corC, UniProt Q9KTE3
>NP_230606.1|Vibrio cholerae O1 biovar El Tor str. N16961|hemolysin
MNEDNSQNSEGPSRKSFFERLSQLFQGEPKDRQELVDVIRDSEVNDLIDHDTRDMLEGVMEIAEMRVRDIMIPRSQMVTIDRTHNLDALVAIMTDAQHSRYPVISEDKDHVEGILLAKDLLKYLGSNCAPFNIQEVIRPAVVVPESKRVDRLLKEFREERYHMAIVVDEFGGVSGLVTIEDILEEIVGDIEDEFDDEEQKDIRQLSKHTFSVKALTTIEDFNHTFGTKFSDEEVDTVGGLVMTAFGHLPARGEVVDIAGYNFKVTAADSRRVVALQVTVPDLEALSHVAEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.62 | 0.00012 | ●○○○○ -0.8 | -0.8016816953416805 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)