Bacterial taxon 243277
Locus VC_0238
Protein NP_229895.1
hexapaptide repeat-containing transferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 188 aa, Gene n/a, UniProt Q9KVA8
>NP_229895.1|Vibrio cholerae O1 biovar El Tor str. N16961|hexapaptide repeat-containing transferase
MQMAGFGLIAKLRNKIRVKPNNKIQIGKNTRIRYCDIYVNGNNNQLIIHNGANLKGVSIELNGNNCLLEIGENCVIGENCFLSCRESGTKLVIGKECMFSRNVKLMTSDGHDILRDGKRINPAKSIYIGSHVWLADNVTILKGVDIGSGSIIGINSTVTKSIGQYCIAAGNPARKIKDNISWNTTLSY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.68 | 0.0028 | ○○○○○ 0.09 | 0.08918256942564118 | 24331463 |
Retrieved 1 of 1 entries in 9.7 ms
(Link to these results)