Bacterial taxon 243277
Locus VC_1206
Protein NP_230851.1
histidine utilization repressor
Vibrio cholerae O1 biovar El Tor str. N16961
Length 236 aa, Gene n/a, UniProt Q9KSQ0
>NP_230851.1|Vibrio cholerae O1 biovar El Tor str. N16961|histidine utilization repressor
MSPRYLQIKQFMLDNIESGRWPVGYRTPTELELTEQFGVSRMTVNKALRDLVSEGKLQRRPRLGTFVCAAEEKAESPLLDIRNIADEILSRGKQYHNKVVEQRALSADEAVAIKLGVMVGSPVFYSEIIHYANDIPMQLEVRWVNSRSVPHYLDQDFTQITPNQYLSQNCPLSAIEHTVEAIVADAHVKQALALAANEPCLLLNRRTWSGDKLVSSALLYHPGSRYKLSSKILFSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.99 | 0.0011 | ○○○○○ 0.86 | 0.8607291412181646 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)