Bacterial taxon 243277
Locus VC_1897
Protein NP_231531.1
Hit family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 116 aa, Gene n/a, UniProt Q9KQV1
>NP_231531.1|Vibrio cholerae O1 biovar El Tor str. N16961|Hit family protein
MAEETIFSKIVRREIPADILYQDELVTAFRDIHPRAPSHILIIPNKLIPTVNDVEVEDELALGRLFTVAKKIAEQEGIAENGYRLIMNCNSHGGQEVYHIHMHLVGGRPLGPLLMG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.34 | 0.0077 | ○○○○○ 0.25 | 0.25003055795556844 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)