Bacterial taxon 243277
Locus VC_1845
Protein NP_231479.1
Holliday junction DNA helicase RuvB
Vibrio cholerae O1 biovar El Tor str. N16961
Length 334 aa, Gene ruvB, UniProt Q9KR02
>NP_231479.1|Vibrio cholerae O1 biovar El Tor str. N16961|Holliday junction DNA helicase RuvB
MIEADRLIAPISNHFKDEEVIDRAIRPKKLADYQGQDHVRDQMEIFIQAAQMRQEALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAALLTNLEENDVLFIDEIHRLSPMVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEYYKVADLQHIVQRSAQCLGLSMDSEGALEVARRARGTPRIANRLLRRVRDYAEVKGDGHICAQTADRALNMLDVDHQGFDYMDRKLLLAIMEKFSGGPVGIDNLAAAIGEEKDTIEDVLEPFLIQQGYLQRTPRGRIATDRAYLHFGIEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.68 | 9.2e-8 | ●○○○○ -0.83 | -0.83223531617806 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)